PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G15070.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 412aa    MW: 45649.3 Da    PI: 7.3287
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G15070.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-1765111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde l +av  + g++Wk+Ia+  +  Rt+ qc +rwqk+l
  LPERR05G15070.2  65 KGGWTPEEDETLRKAVDIYNGKNWKKIAQSCP-DRTEVQCLHRWQKVL 111
                      688*****************************.************986 PP

2Myb_DNA-binding59.85.8e-19117163148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+ +++ vk++G++ W+ Iar ++ gR +kqc++rw+++l
  LPERR05G15070.2 117 KGPWTQEEDDVIINMVKKHGPKKWSVIARSLN-GRIGKQCRERWHNHL 163
                      79******************************.*************97 PP

3Myb_DNA-binding27.57.1e-09169204138
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38 
                      + +WT eE+  l++a+ ++G++ W+ Ia+ ++ g t +
  LPERR05G15070.2 169 KEAWTVEEERVLARAHCMYGNK-WAEIAKLLP-GSTSN 204
                      579*******************.*********.86665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.58460111IPR017930Myb domain
SMARTSM007178.7E-1464113IPR001005SANT/Myb domain
PfamPF002492.1E-1565111IPR001005SANT/Myb domain
SuperFamilySSF466895.46E-1666121IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-2267119IPR009057Homeodomain-like
CDDcd001671.53E-1268111No hitNo description
PROSITE profilePS5129430.662112167IPR017930Myb domain
SuperFamilySSF466895.59E-27114206IPR009057Homeodomain-like
SMARTSM007174.1E-17116165IPR001005SANT/Myb domain
PfamPF002494.2E-17117163IPR001005SANT/Myb domain
CDDcd001672.82E-15119163No hitNo description
Gene3DG3DSA:1.10.10.601.0E-25120166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-13167204IPR009057Homeodomain-like
SMARTSM007170.47168227IPR001005SANT/Myb domain
PROSITE profilePS512947.788168218IPR017930Myb domain
PfamPF002491.4E-7169203IPR001005SANT/Myb domain
CDDcd001677.91E-5171204No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MLPAVKVEAV DGSGEGIQRN LMALSSASSA SEGSGYALTS PVTSSPADAS IFSSRRKSGP  60
VRRAKGGWTP EEDETLRKAV DIYNGKNWKK IAQSCPDRTE VQCLHRWQKV LNPELIKGPW  120
TQEEDDVIIN MVKKHGPKKW SVIARSLNGR IGKQCRERWH NHLDPQIRKE AWTVEEERVL  180
ARAHCMYGNK WAEIAKLLPG STSNILRVQL PAIGDDLKPS AENHIDLNKE PIIYSRDCQG  240
LVDHSDPTSD QQAMKMDSVH GETTGNNFLC GKVQRINLVV ENGFQTDQIS DKMGCSRLAK  300
REGEAVINGG ESSLQSEAHS VGFLCYENPK NEDTVPAQSP MFSAHYVPEH SRDEVHSPNG  360
YTTPSPTSRK GSDQLSVDSI LRSAAENFRE MTSNELKWVR PVASKVTVPE AK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C8e-62642075148MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-62642075148MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1067561e-129AK106756.1 Oryza sativa Japonica Group cDNA clone:002-115-D07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655378.20.0PREDICTED: uncharacterized protein LOC102711889
TrEMBLA0A0D9WHB00.0A0A0D9WHB0_9ORYZ; Uncharacterized protein
STRINGOB05G26770.10.0(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.26e-87myb domain protein 3r-5